(data stored in ACNUC30630 zone)

EMBL: CP001606.RPLU

CP001606.RPLU        Location/Qualifiers
FT   CDS             372655..372963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="Balat_0302"
FT                   /product="50S ribosomal protein L21"
FT                   /note="COG0261 Ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47258"
FT                   /protein_id="ACS47258.1"
FT                   /translation="MYAIVKAGGHQEKVEVGDTILVNRLDAKNGETVEFPVALVVDGEK
FT                   VIIAAADLAKISVKAEVVNDDAKGPKIRIQKFKNKTGVARRKGHRQKLTQLKITAIA"
     MYAIVKAGGH QEKVEVGDTI LVNRLDAKNG ETVEFPVALV VDGEKVIIAA ADLAKISVKA        60
     EVVNDDAKGP KIRIQKFKNK TGVARRKGHR QKLTQLKITA IA                          102
//

If you have problems or comments...

PBIL Back to PBIL home page