(data stored in ACNUC30630 zone)

EMBL: CP001606.RPMG

CP001606.RPMG        Location/Qualifiers
FT   CDS             446150..446320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="Balat_0363"
FT                   /product="50S ribosomal protein L33"
FT                   /note="COG0267 Ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47314"
FT                   /protein_id="ACS47314.1"
FT                   /translation="MASKSADIRPGITLACTVCKERNYITTKNRRNTPDRLELKKFCPK
FT                   CGKQTLHRETR"
     MASKSADIRP GITLACTVCK ERNYITTKNR RNTPDRLELK KFCPKCGKQT LHRETR            56
//

If you have problems or comments...

PBIL Back to PBIL home page