(data stored in ACNUC30630 zone)

EMBL: CP001606.RPSI

CP001606.RPSI        Location/Qualifiers
FT   CDS             458747..459238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="Balat_0375"
FT                   /product="30S ribosomal protein S9"
FT                   /note="COG0103 Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47325"
FT                   /protein_id="ACS47325.1"
FT                   /translation="MAENTNNSAVTETEETTAAFTTETNSGAGTGTSTIAPGYGTGRRK
FT                   EAVARVRLVPGTGEWKINGRTLEEYFPSKLLQREVNSPIVLLKLEGKFDAIVLVDGGGT
FT                   TGQAGAIRLGVARALNAIDRDANRAALKKAGFLTRDARVVERKKVGLHKARRAPQFSKR
FT                   "
     MAENTNNSAV TETEETTAAF TTETNSGAGT GTSTIAPGYG TGRRKEAVAR VRLVPGTGEW        60
     KINGRTLEEY FPSKLLQREV NSPIVLLKLE GKFDAIVLVD GGGTTGQAGA IRLGVARALN       120
     AIDRDANRAA LKKAGFLTRD ARVVERKKVG LHKARRAPQF SKR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page