(data stored in ACNUC30630 zone)

EMBL: CP001606.RPSM

CP001606.RPSM        Location/Qualifiers
FT   CDS             481560..481937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="Balat_0406"
FT                   /product="30S ribosomal protein S13"
FT                   /note="COG0099 Ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47356"
FT                   /protein_id="ACS47356.1"
FT                   /translation="MARLAGVDIPNDKRIEVALTYIFGVGRTRAKETLEATGINPDTRV
FT                   KDLTDEQLITLRDYLESNYKIEGDLRREVDADIRRKIQINSYQGMRHRKGLPVRGQRTK
FT                   TNARTRKGPKRTVAGKKKATK"
     MARLAGVDIP NDKRIEVALT YIFGVGRTRA KETLEATGIN PDTRVKDLTD EQLITLRDYL        60
     ESNYKIEGDL RREVDADIRR KIQINSYQGM RHRKGLPVRG QRTKTNARTR KGPKRTVAGK       120
     KKATK                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page