(data stored in ACNUC7421 zone)

EMBL: CP001622.PE1

CP001622.PE1         Location/Qualifiers
FT   CDS             55..1605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: rec:RHECIAT_CH0000397 chromosomal replication
FT                   initiator protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54313"
FT                   /db_xref="GOA:C6AY89"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY89"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACS54313.1"
FT                   /translation="MQMNTMTTSGLDNGDAAPQAFGSIRLEAAEVKADMKQNVLFERVT
FT                   ARLKAQVGQDVYASWFARLKLHSVSKSVVRLSVPTTFLKSWINNRYLDLITGLFQAEDP
FT                   EILKIEVLVRTATRHGTKALDEAVAPEPAAPTQMRRPASAQPAGQAVQQAVSAVAAARP
FT                   ASFGSPLFGSPLDSRFTFDTFVEGSSNRVALAAAKTIAEAGQGAVRFNPLFIHSTVGLG
FT                   KTHLLQAVANAAVQNPRALRVVYLTAEYFMWRFATAIRDNDALTLKDSLRNIDLLIIDD
FT                   MQFLQGKMIQHEFCHLLNMLLDSAKQVVVAADRAPWELESLDPRVRSRLQGGVAIEFDA
FT                   PDYEMRLEILKRRLAVARLEDPSLEIPAELLQHVARNVTASGRELEGAFNQLVFRRSFE
FT                   PNLSIERVDELLAHLVGSGEPRRVRIEDIQRIVARHYNVSRQELVSNRRTRVIVKPRQI
FT                   AMYLSKTLTPRSFPEIGRRFGGRDHTTVLHAVRKIEELISGDTKLSHEVELLKRLINE"
     MQMNTMTTSG LDNGDAAPQA FGSIRLEAAE VKADMKQNVL FERVTARLKA QVGQDVYASW        60
     FARLKLHSVS KSVVRLSVPT TFLKSWINNR YLDLITGLFQ AEDPEILKIE VLVRTATRHG       120
     TKALDEAVAP EPAAPTQMRR PASAQPAGQA VQQAVSAVAA ARPASFGSPL FGSPLDSRFT       180
     FDTFVEGSSN RVALAAAKTI AEAGQGAVRF NPLFIHSTVG LGKTHLLQAV ANAAVQNPRA       240
     LRVVYLTAEY FMWRFATAIR DNDALTLKDS LRNIDLLIID DMQFLQGKMI QHEFCHLLNM       300
     LLDSAKQVVV AADRAPWELE SLDPRVRSRL QGGVAIEFDA PDYEMRLEIL KRRLAVARLE       360
     DPSLEIPAEL LQHVARNVTA SGRELEGAFN QLVFRRSFEP NLSIERVDEL LAHLVGSGEP       420
     RRVRIEDIQR IVARHYNVSR QELVSNRRTR VIVKPRQIAM YLSKTLTPRS FPEIGRRFGG       480
     RDHTTVLHAV RKIEELISGD TKLSHEVELL KRLINE                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page