(data stored in ACNUC7421 zone)

EMBL: CP001622.PE10

CP001622.PE10        Location/Qualifiers
FT   CDS             9139..9564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0010"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   ret:RHE_CH00367 molecular chaperone small heat shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54322"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY98"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACS54322.1"
FT                   /translation="MSRITPFASPLLLGFDAMEKTLERISKASDGYPPYNIERIGADSG
FT                   APERLRITLAVAGFSEEELDVSIEENQLLIRGRQVEQGERDYLYRGIAARQFQRTFVLA
FT                   DGMQVLGAALKNGLLSVDLIRPEPARMVKKINISVSQ"
     MSRITPFASP LLLGFDAMEK TLERISKASD GYPPYNIERI GADSGAPERL RITLAVAGFS        60
     EEELDVSIEE NQLLIRGRQV EQGERDYLYR GIAARQFQRT FVLADGMQVL GAALKNGLLS       120
     VDLIRPEPAR MVKKINISVS Q                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page