(data stored in ACNUC7421 zone)

EMBL: CP001622.PE102

CP001622.PE102       Location/Qualifiers
FT   CDS             complement(98779..99300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A6246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54414"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ88"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_A6246"
FT                   /protein_id="ACS54414.1"
FT                   /translation="MHNAKFIRHAAVSACVAFAAFQAGQVLADSANDKFFDAALCKPPY
FT                   TMTSAMKVYDVVEALAKPDTSSLGAAIYKLPNQIGRDGFKSTEIFFANNAVGVLVEGER
FT                   ADDLAVKYGLKPETSDLLGTSTKGYSRELPADLQPEPGMAGPGKVSIVARQGNALPGKT
FT                   LLACEFVQEF"
     MHNAKFIRHA AVSACVAFAA FQAGQVLADS ANDKFFDAAL CKPPYTMTSA MKVYDVVEAL        60
     AKPDTSSLGA AIYKLPNQIG RDGFKSTEIF FANNAVGVLV EGERADDLAV KYGLKPETSD       120
     LLGTSTKGYS RELPADLQPE PGMAGPGKVS IVARQGNALP GKTLLACEFV QEF              173
//

If you have problems or comments...

PBIL Back to PBIL home page