(data stored in ACNUC7421 zone)

EMBL: CP001622.PE104

CP001622.PE104       Location/Qualifiers
FT   CDS             99716..100012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54416"
FT                   /db_xref="GOA:C6AZ90"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54416.1"
FT                   /translation="MTDMLACPSCGLDKTESIVHRGFYILRCAACGEAIVATSFMAMRD
FT                   SDHLCSAFIDPGPGKPPPPEMLVARGPLRQIATAISAAANDGTLIRLISEVKD"
     MTDMLACPSC GLDKTESIVH RGFYILRCAA CGEAIVATSF MAMRDSDHLC SAFIDPGPGK        60
     PPPPEMLVAR GPLRQIATAI SAAANDGTLI RLISEVKD                                98
//

If you have problems or comments...

PBIL Back to PBIL home page