(data stored in ACNUC7421 zone)

EMBL: CP001622.PE106

CP001622.PE106       Location/Qualifiers
FT   CDS             100978..101565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54418"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ92"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000510"
FT                   /protein_id="ACS54418.1"
FT                   /translation="MAEFNPRDKSRTSQGKTRAMVRRHTAPPSGMDDGSLRWQWFTIQL
FT                   LESAAFTTLSANACRAFFRIVIEHTSHAALENGKLVVTHPQFVSYGVTGEYVADAIDEL
FT                   EYKGLIKVRRGRAGSGVAHPNRFTLTFVGDHEGAPPTDEWKRCTAERCRKWSETDRKIA
FT                   ADKRGRVGRKKKTPLRNPEIPPLRDSEIRRAS"
     MAEFNPRDKS RTSQGKTRAM VRRHTAPPSG MDDGSLRWQW FTIQLLESAA FTTLSANACR        60
     AFFRIVIEHT SHAALENGKL VVTHPQFVSY GVTGEYVADA IDELEYKGLI KVRRGRAGSG       120
     VAHPNRFTLT FVGDHEGAPP TDEWKRCTAE RCRKWSETDR KIAADKRGRV GRKKKTPLRN       180
     PEIPPLRDSE IRRAS                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page