(data stored in ACNUC7421 zone)

EMBL: CP001622.PE107

CP001622.PE107       Location/Qualifiers
FT   CDS             complement(101656..102354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0108"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bja:blr7575 O-methyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54419"
FT                   /db_xref="GOA:C6AZ93"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ93"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACS54419.1"
FT                   /translation="MASPWVNDALSHAQSAFSGNSNTDILEVGGGSRTHIPLKGARYTV
FT                   VDISKEQLEKNRDAAERILGDAQTIDYGDRHFDACVFWDVLEHLESPRSALLRAHDTLS
FT                   PGGLVFVKGPILNSAKGIFTDLTPWWTHVLFYRYVLRQKNAGKPGYAPFRVEHAAEASH
FT                   SEIAGTLKDLGMDVVFVGEYVSTQVHALKDRIPPLYWLYEAFGLLLRTTSAGKIGGRET
FT                   EFLIVAKCLR"
     MASPWVNDAL SHAQSAFSGN SNTDILEVGG GSRTHIPLKG ARYTVVDISK EQLEKNRDAA        60
     ERILGDAQTI DYGDRHFDAC VFWDVLEHLE SPRSALLRAH DTLSPGGLVF VKGPILNSAK       120
     GIFTDLTPWW THVLFYRYVL RQKNAGKPGY APFRVEHAAE ASHSEIAGTL KDLGMDVVFV       180
     GEYVSTQVHA LKDRIPPLYW LYEAFGLLLR TTSAGKIGGR ETEFLIVAKC LR               232
//

If you have problems or comments...

PBIL Back to PBIL home page