(data stored in ACNUC7421 zone)

EMBL: CP001622.PE108

CP001622.PE108       Location/Qualifiers
FT   CDS             102554..102874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54420"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ94"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000511"
FT                   /protein_id="ACS54420.1"
FT                   /translation="MTVGIFRALAALAMMTALGGCIDHANDPVLLAVGVPVNPPVVAHG
FT                   ICMTDGNAMYDEARKQYQLRAQLTGYAGADELEAETIARAAAHRQYVACLSGQGYRTLY
FT                   AN"
     MTVGIFRALA ALAMMTALGG CIDHANDPVL LAVGVPVNPP VVAHGICMTD GNAMYDEARK        60
     QYQLRAQLTG YAGADELEAE TIARAAAHRQ YVACLSGQGY RTLYAN                      106
//

If you have problems or comments...

PBIL Back to PBIL home page