(data stored in ACNUC7421 zone)

EMBL: CP001622.PE109

CP001622.PE109       Location/Qualifiers
FT   CDS             103066..103437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54421"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ95"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000512"
FT                   /protein_id="ACS54421.1"
FT                   /translation="MKMLRLAPSTVALSALLALTSIIPAQAAPAQAVRPPAVSGVKMVQ
FT                   YKPHPGSWHGYQGFRTERPGTRRHSDGYWYPLAAFGVEAGTTGSIVRPPVNRPAAPEMC
FT                   NPTFSGSIGPGSMPCDNGY"
     MKMLRLAPST VALSALLALT SIIPAQAAPA QAVRPPAVSG VKMVQYKPHP GSWHGYQGFR        60
     TERPGTRRHS DGYWYPLAAF GVEAGTTGSI VRPPVNRPAA PEMCNPTFSG SIGPGSMPCD       120
     NGY                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page