(data stored in ACNUC7421 zone)

EMBL: CP001622.PE11

CP001622.PE11        Location/Qualifiers
FT   CDS             9612..9869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0011"
FT                   /product="protein of unknown function DUF1150"
FT                   /note="PFAM: protein of unknown function DUF1150; KEGG:
FT                   rec:RHECIAT_CH0000407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54323"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY99"
FT                   /inference="protein motif:PFAM:PF06620"
FT                   /protein_id="ACS54323.1"
FT                   /translation="MLMKEATSHLTKSELAHIGNGEVAYIRKMRTDEVAKCFPEAPDID
FT                   PTVDLWALFGADGTPILLTDNRSSTFFKAAEDELKTVSLH"
     MLMKEATSHL TKSELAHIGN GEVAYIRKMR TDEVAKCFPE APDIDPTVDL WALFGADGTP        60
     ILLTDNRSST FFKAAEDELK TVSLH                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page