(data stored in ACNUC7421 zone)

EMBL: CP001622.PE110

CP001622.PE110       Location/Qualifiers
FT   CDS             103592..103894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54422"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ96"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000513"
FT                   /protein_id="ACS54422.1"
FT                   /translation="MTTTFKNGLMAAAFGTILGLSAFSATAAPLQSSATEQGATTRPVA
FT                   QQETKVEHDRRTTGSIGERASETTGSTHYMMNPKKPLNQDCKLGFNPTSSSSCNY"
     MTTTFKNGLM AAAFGTILGL SAFSATAAPL QSSATEQGAT TRPVAQQETK VEHDRRTTGS        60
     IGERASETTG STHYMMNPKK PLNQDCKLGF NPTSSSSCNY                             100
//

If you have problems or comments...

PBIL Back to PBIL home page