(data stored in ACNUC7421 zone)

EMBL: CP001622.PE111

CP001622.PE111       Location/Qualifiers
FT   CDS             104191..104862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0112"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG:
FT                   ret:RHE_CH00448 phospholipid N-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54423"
FT                   /db_xref="GOA:C6AZ97"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ97"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACS54423.1"
FT                   /translation="MTAKAACSDFLHFFRSWISNPLRVAAIAPSGDSLARIMTSEIAAL
FT                   DGPIIELGPGTGVFTRALLARGVSEADLTLIEYGPEFITSLQARFPTARVLQMDAAHLA
FT                   HADIFEGEPVGAVVSGLPLLSMSPRKIASIMAGAFAYMRPGGAIYQFTYGPRCPVPRPI
FT                   LDRLGLKAVRIGGTVRNLPPASVYRISRRKPLELSRERISYRQSETEIDDVAAFSNETG
FT                   G"
     MTAKAACSDF LHFFRSWISN PLRVAAIAPS GDSLARIMTS EIAALDGPII ELGPGTGVFT        60
     RALLARGVSE ADLTLIEYGP EFITSLQARF PTARVLQMDA AHLAHADIFE GEPVGAVVSG       120
     LPLLSMSPRK IASIMAGAFA YMRPGGAIYQ FTYGPRCPVP RPILDRLGLK AVRIGGTVRN       180
     LPPASVYRIS RRKPLELSRE RISYRQSETE IDDVAAFSNE TGG                         223
//

If you have problems or comments...

PBIL Back to PBIL home page