(data stored in ACNUC7421 zone)

EMBL: CP001622.PE112

CP001622.PE112       Location/Qualifiers
FT   CDS             104882..105517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0113"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54424"
FT                   /db_xref="GOA:C6AZ98"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ98"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54424.1"
FT                   /translation="MAENKRTETTEGRRERKRRQTRERIEHAAMSLFLQRGFEGTTIED
FT                   ITEAADVSKRSFFDYFPSKEEVVFAWQDAFADRLMAAVAARPAAESSVAAVEAAITATV
FT                   IAAVDEPGLALGELIHRTPALKARDQLKYARLEQKLAEALLLRKGGDPLERPRMRVLAA
FT                   VVIGALRVGAELWQQRPPGASLEDFAREIFADLWKMLAEFGDEAKTRL"
     MAENKRTETT EGRRERKRRQ TRERIEHAAM SLFLQRGFEG TTIEDITEAA DVSKRSFFDY        60
     FPSKEEVVFA WQDAFADRLM AAVAARPAAE SSVAAVEAAI TATVIAAVDE PGLALGELIH       120
     RTPALKARDQ LKYARLEQKL AEALLLRKGG DPLERPRMRV LAAVVIGALR VGAELWQQRP       180
     PGASLEDFAR EIFADLWKML AEFGDEAKTR L                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page