(data stored in ACNUC7421 zone)

EMBL: CP001622.PE113

CP001622.PE113       Location/Qualifiers
FT   CDS             105825..106706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0114"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG:
FT                   rec:RHECIAT_CH0000515 probable oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54425"
FT                   /db_xref="GOA:C6AZ99"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ99"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACS54425.1"
FT                   /translation="MSNYNAAKSGTFKIGGNIEINRLGFGAMRVTGKGIWGEPSDHAES
FT                   IRTLKRLPELGVNFIDTADSYGPDVSEWLIKEALHPYGGKSVIATKGGLTRHGPDIWLP
FT                   VGRPEYLIQQAHKSLRNLGVEQIDLWQLHRIDQKVPAKEQFDAIKSLLDTGLIRHAGLS
FT                   EVSVADIEAASKHFKVATVQNRYNLVDRTSEDVLDYCTKHNIGFIPWYPLAAGDLAKPG
FT                   SLLDTIAKKHNAAPSRIALAWVLKRSPVMLPIPGTSKVKHLEENVAAVDIALSDEEFSA
FT                   LDAEGSKVFKAA"
     MSNYNAAKSG TFKIGGNIEI NRLGFGAMRV TGKGIWGEPS DHAESIRTLK RLPELGVNFI        60
     DTADSYGPDV SEWLIKEALH PYGGKSVIAT KGGLTRHGPD IWLPVGRPEY LIQQAHKSLR       120
     NLGVEQIDLW QLHRIDQKVP AKEQFDAIKS LLDTGLIRHA GLSEVSVADI EAASKHFKVA       180
     TVQNRYNLVD RTSEDVLDYC TKHNIGFIPW YPLAAGDLAK PGSLLDTIAK KHNAAPSRIA       240
     LAWVLKRSPV MLPIPGTSKV KHLEENVAAV DIALSDEEFS ALDAEGSKVF KAA              293
//

If you have problems or comments...

PBIL Back to PBIL home page