(data stored in ACNUC7421 zone)

EMBL: CP001622.PE114

CP001622.PE114       Location/Qualifiers
FT   CDS             107377..108654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0115"
FT                   /product="protein of unknown function DUF900 hydrolase
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF900 hydrolase
FT                   family protein; KEGG: rec:RHECIAT_CH0000517 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54426"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA0"
FT                   /inference="protein motif:PFAM:PF05990"
FT                   /protein_id="ACS54426.1"
FT                   /translation="MIGKRGGLPAALTGLLIATMALAGCGGRPVGVMQAAGTAAPGTSK
FT                   VDLLVATTRAADDNPAVLFSGERGTGLAVNAVDVSIPPEANRKVGQVQWPSRLPADPLR
FT                   DFVTVSVDPLEGERAGETWLKSHMPKSRRVLVFVHGFNNRYEDAVYRFAQIVHDSHADV
FT                   APVVFTWPSRGSIFDYNYDKESTNYSRDALEELLTRTAANPAVSDVTIMAHSMGTWLTV
FT                   EALRQMAIRNGHVASKINNVILASPDLDVDVFGRQFASLGKERPHFTIFVSQDDRALAL
FT                   SRRISGNVDRLGQIDPSVEPYRSKLEAAGITVLDLTKLKGGDRLNHGKFAESPEVVKLI
FT                   GDRLIAGQTITDSNVGLGEAVGAVAMGAAQTAGSAVSVAVSTPIAIFDPRTRRNYDAQL
FT                   KRLGQSMNNTVGSVGDSVGAGLPASQ"
     MIGKRGGLPA ALTGLLIATM ALAGCGGRPV GVMQAAGTAA PGTSKVDLLV ATTRAADDNP        60
     AVLFSGERGT GLAVNAVDVS IPPEANRKVG QVQWPSRLPA DPLRDFVTVS VDPLEGERAG       120
     ETWLKSHMPK SRRVLVFVHG FNNRYEDAVY RFAQIVHDSH ADVAPVVFTW PSRGSIFDYN       180
     YDKESTNYSR DALEELLTRT AANPAVSDVT IMAHSMGTWL TVEALRQMAI RNGHVASKIN       240
     NVILASPDLD VDVFGRQFAS LGKERPHFTI FVSQDDRALA LSRRISGNVD RLGQIDPSVE       300
     PYRSKLEAAG ITVLDLTKLK GGDRLNHGKF AESPEVVKLI GDRLIAGQTI TDSNVGLGEA       360
     VGAVAMGAAQ TAGSAVSVAV STPIAIFDPR TRRNYDAQLK RLGQSMNNTV GSVGDSVGAG       420
     LPASQ                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page