(data stored in ACNUC7421 zone)

EMBL: CP001622.PE115

CP001622.PE115       Location/Qualifiers
FT   CDS             108839..110089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0116"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.6"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ret:RHE_CH00451 D-amino acid dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54427"
FT                   /db_xref="GOA:C6AZA1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA1"
FT                   /inference="protein motif:PRIAM:1.4.99.1"
FT                   /protein_id="ACS54427.1"
FT                   /translation="MADETKKTVAVVGAGVIGASIAFELQRRGFDVTLIDKGEPGRGTS
FT                   FGNMASIALDFAAGSGPSTWKKIPGWLLDPEGPVWLRPSYAARMLPWFLRFLAAGRPSR
FT                   LREIEDAGMRLSNRALGDFRQMLQAIGAPELMTEEGCLAIYETEAEFAADRGHLAMMQR
FT                   YGLEFEVLSNGAIQHYEPTLSPAIAKAVLLPDNKSIRDPYKLVVKLADAAKAAGTTFVS
FT                   GTVRNIERRGDGTAVVLLEDGRRIEAGSVVLAAGVHTRFLAEKLGEPIPLETERGYHTQ
FT                   IMKPGIAMRYSVIWPHRAFMVTPTAGGIRVGGNVELAGLDAAPDFRRPRVLVRHAQRAL
FT                   PGLKVEETTEWMGHRPALPDTIPIISPSSKLPGVFYATGHGHLGLTFSATTALVIADMV
FT                   TGLKPSLDMTPFRIDRY"
     MADETKKTVA VVGAGVIGAS IAFELQRRGF DVTLIDKGEP GRGTSFGNMA SIALDFAAGS        60
     GPSTWKKIPG WLLDPEGPVW LRPSYAARML PWFLRFLAAG RPSRLREIED AGMRLSNRAL       120
     GDFRQMLQAI GAPELMTEEG CLAIYETEAE FAADRGHLAM MQRYGLEFEV LSNGAIQHYE       180
     PTLSPAIAKA VLLPDNKSIR DPYKLVVKLA DAAKAAGTTF VSGTVRNIER RGDGTAVVLL       240
     EDGRRIEAGS VVLAAGVHTR FLAEKLGEPI PLETERGYHT QIMKPGIAMR YSVIWPHRAF       300
     MVTPTAGGIR VGGNVELAGL DAAPDFRRPR VLVRHAQRAL PGLKVEETTE WMGHRPALPD       360
     TIPIISPSSK LPGVFYATGH GHLGLTFSAT TALVIADMVT GLKPSLDMTP FRIDRY           416
//

If you have problems or comments...

PBIL Back to PBIL home page