(data stored in ACNUC7421 zone)

EMBL: CP001622.PE116

CP001622.PE116       Location/Qualifiers
FT   CDS             110099..110809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0117"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54428"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54428.1"
FT                   /translation="MSDTAKPVALITGGGRGMGEAIARELSAQGYRLALMSPSESCEKL
FT                   AAELGGVASRGVAEKAEDLKAIFDLTMKTYGRIDAVVNLSGHPPKGDLLDISDENWTLG
FT                   SDMMILSLVRMARLVTPVMLKQGKGAFVNITTFAAYEPTLVFPVSCTYRAAAGAFTKLY
FT                   SDRYAADNIRMNCILPGYIDSLNHKPETAEKVPMKRIGHVEEIAKTAAFLLSDGAGYIT
FT                   GQNIRVDGGVTRHV"
     MSDTAKPVAL ITGGGRGMGE AIARELSAQG YRLALMSPSE SCEKLAAELG GVASRGVAEK        60
     AEDLKAIFDL TMKTYGRIDA VVNLSGHPPK GDLLDISDEN WTLGSDMMIL SLVRMARLVT       120
     PVMLKQGKGA FVNITTFAAY EPTLVFPVSC TYRAAAGAFT KLYSDRYAAD NIRMNCILPG       180
     YIDSLNHKPE TAEKVPMKRI GHVEEIAKTA AFLLSDGAGY ITGQNIRVDG GVTRHV           236
//

If you have problems or comments...

PBIL Back to PBIL home page