(data stored in ACNUC7421 zone)

EMBL: CP001622.PE117

CP001622.PE117       Location/Qualifiers
FT   CDS             110825..111862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0118"
FT                   /product="Proline racemase"
FT                   /EC_number="5.1.1.4"
FT                   /note="PFAM: proline racemase; KEGG: ret:RHE_CH00452
FT                   proline racemase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54429"
FT                   /db_xref="GOA:C6AZA3"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA3"
FT                   /inference="protein motif:PRIAM:5.1.1.4"
FT                   /protein_id="ACS54429.1"
FT                   /translation="MRWKRTIQLLDVHAEGEIGRVAIGGVPKIPGETIAAQLHWLNTDP
FT                   KGDELRRFLCLEPRGAPIGSVNLLLPARHPEADAAFIILQPDQAHASSGSNSICVTTAL
FT                   LESGIVEMKEPETIVTLETAAGLVKATATCRDGRCEKVKLTMVPSFVHELDVAIDTPHW
FT                   GRIKADISYGGIFYALVDVGQIGLTIEKANAAGLVQAGMILKELINRDIKVVHPEIPAI
FT                   SGVAYVMFRDTEADGTVRTCTTMWPGRADRSPCGTGNSANLATLYARGKAKVGDTFTSK
FT                   SIIGSEFEVGLQAVTEVAGRPAVIPTITGRGFTFGLTQVALDPFDPHPNGFALTDVWGP
FT                   SAGEI"
     MRWKRTIQLL DVHAEGEIGR VAIGGVPKIP GETIAAQLHW LNTDPKGDEL RRFLCLEPRG        60
     APIGSVNLLL PARHPEADAA FIILQPDQAH ASSGSNSICV TTALLESGIV EMKEPETIVT       120
     LETAAGLVKA TATCRDGRCE KVKLTMVPSF VHELDVAIDT PHWGRIKADI SYGGIFYALV       180
     DVGQIGLTIE KANAAGLVQA GMILKELINR DIKVVHPEIP AISGVAYVMF RDTEADGTVR       240
     TCTTMWPGRA DRSPCGTGNS ANLATLYARG KAKVGDTFTS KSIIGSEFEV GLQAVTEVAG       300
     RPAVIPTITG RGFTFGLTQV ALDPFDPHPN GFALTDVWGP SAGEI                       345
//

If you have problems or comments...

PBIL Back to PBIL home page