(data stored in ACNUC7421 zone)

EMBL: CP001622.PE118

CP001622.PE118       Location/Qualifiers
FT   CDS             111968..113086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0119"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ecd:ECDH10B_2558 IS186/IS421 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54430"
FT                   /db_xref="GOA:C6AZA4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACS54430.1"
FT                   /translation="MKIRPEVLDHWPEVRERLPAGFDLEATARLRGAFTRVREIKNAET
FT                   LLRLALAYGGLGMSLRETCAWAEAGGIARLSDPSLLERLCKAAPWLGDIVAALIAEQAK
FT                   VPTGRFAGYRLRVLDGTSICHPGADRTTWRLHVGYDLATAQVDQLELTDIHGAENLQRL
FT                   TYAPGDIVLADRYYARPRDLRPVIDAGADFIVRTGWNSLRLLQTNGEPFDLFAALAAQQ
FT                   EQEGEVQVRVHEGMTGTPPPPPLALRLIVRRKDPQQAQAEQERLLKAARKHGKKPDPRS
FT                   LEAAKYILLLTSLPATTFPPADILTLYRFRWQIELAFKRFKSLAGLDSLPAKKPELARA
FT                   WLYARLIVAIIAEQIAGQVPDSPPSGCGNPTG"
     MKIRPEVLDH WPEVRERLPA GFDLEATARL RGAFTRVREI KNAETLLRLA LAYGGLGMSL        60
     RETCAWAEAG GIARLSDPSL LERLCKAAPW LGDIVAALIA EQAKVPTGRF AGYRLRVLDG       120
     TSICHPGADR TTWRLHVGYD LATAQVDQLE LTDIHGAENL QRLTYAPGDI VLADRYYARP       180
     RDLRPVIDAG ADFIVRTGWN SLRLLQTNGE PFDLFAALAA QQEQEGEVQV RVHEGMTGTP       240
     PPPPLALRLI VRRKDPQQAQ AEQERLLKAA RKHGKKPDPR SLEAAKYILL LTSLPATTFP       300
     PADILTLYRF RWQIELAFKR FKSLAGLDSL PAKKPELARA WLYARLIVAI IAEQIAGQVP       360
     DSPPSGCGNP TG                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page