(data stored in ACNUC7421 zone)

EMBL: CP001622.PE119

CP001622.PE119       Location/Qualifiers
FT   CDS             complement(113470..114153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0120"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rpt:Rpal_2059
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54431"
FT                   /db_xref="GOA:C6AZA5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54431.1"
FT                   /translation="MQKSDETSNVDETPTRGRGRPRAFDREAALAQATRLFWIKGFEAT
FT                   SIADLTEAMGIGSPSLYAAFGSKEALYAEALRHYRDNNEALVWGGFFSAGTAREAVRSF
FT                   LMDSAAALTGCVVDIPRGCMVALSSVGSEGHVELGELVRAARAVTLDRLKLRLNQAISE
FT                   GEIPVSTDVHALARFVQTVQNGMSILARDGATRGELEAVAELAMLGWDTRTGDSERRQT
FT                   YADHA"
     MQKSDETSNV DETPTRGRGR PRAFDREAAL AQATRLFWIK GFEATSIADL TEAMGIGSPS        60
     LYAAFGSKEA LYAEALRHYR DNNEALVWGG FFSAGTAREA VRSFLMDSAA ALTGCVVDIP       120
     RGCMVALSSV GSEGHVELGE LVRAARAVTL DRLKLRLNQA ISEGEIPVST DVHALARFVQ       180
     TVQNGMSILA RDGATRGELE AVAELAMLGW DTRTGDSERR QTYADHA                     227
//

If you have problems or comments...

PBIL Back to PBIL home page