(data stored in ACNUC7421 zone)

EMBL: CP001622.PE12

CP001622.PE12        Location/Qualifiers
FT   CDS             complement(10030..10296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02662 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54324"
FT                   /db_xref="InterPro:IPR018735"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA0"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH02662"
FT                   /protein_id="ACS54324.1"
FT                   /translation="MCRNIKPLFNFDPPATDEEIHDAALQFVRKVSGATKPSKRDELAF
FT                   EHAVSSIAACARELLDSLETSQPPRDREEVAAKARARTAVRFA"
     MCRNIKPLFN FDPPATDEEI HDAALQFVRK VSGATKPSKR DELAFEHAVS SIAACARELL        60
     DSLETSQPPR DREEVAAKAR ARTAVRFA                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page