(data stored in ACNUC7421 zone)

EMBL: CP001622.PE120

CP001622.PE120       Location/Qualifiers
FT   CDS             114235..114975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0121"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: atc:AGR_pAT_252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54432"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54432.1"
FT                   /translation="MTELAGKRALVTGGSRGIGAAIALALADKGADVAITYERSADRAA
FT                   EVVRAIEGKGRKALAIQADSADPAAVKRSVDEAAQALGGLDILVNNAAIALYGAIADVS
FT                   VEQIDALLDVNVRSPLLASQAAIPYLQAGGRVITIGSVGAERIVGDTGTVYYMTKSALH
FT                   SFTRGLARELGSRDITVNLVQPGSTDTDMNPADGDFADFQRALIPLGRYGEPEDVAAAV
FT                   AFLASPAARHITGTILTVDGGLNT"
     MTELAGKRAL VTGGSRGIGA AIALALADKG ADVAITYERS ADRAAEVVRA IEGKGRKALA        60
     IQADSADPAA VKRSVDEAAQ ALGGLDILVN NAAIALYGAI ADVSVEQIDA LLDVNVRSPL       120
     LASQAAIPYL QAGGRVITIG SVGAERIVGD TGTVYYMTKS ALHSFTRGLA RELGSRDITV       180
     NLVQPGSTDT DMNPADGDFA DFQRALIPLG RYGEPEDVAA AVAFLASPAA RHITGTILTV       240
     DGGLNT                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page