(data stored in ACNUC7421 zone)

EMBL: CP001622.PE121

CP001622.PE121       Location/Qualifiers
FT   CDS             complement(115478..117025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0122"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: rec:RHECIAT_CH0000527 putative sensory
FT                   box/GGDEF family protein; TIGRFAM: diguanylate cyclase;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   SMART: EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54433"
FT                   /db_xref="GOA:C6AZA7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA7"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS54433.1"
FT                   /translation="MPRSQPTRPQIEIVAWLAIFLLLFCLSWLFQWHEGLDEFIEKHHD
FT                   YPLDHALLALNISGFLGLIYSALRIRDLSREVHRRLQAEKNVDWIACHDTLTELPNRRF
FT                   LDSICAQAMSDQRAQETYAVFSIDLDGFKKVNDLLGHDHGDAVLKTVAQRLSSLFPRER
FT                   VFRLGGDEFVVLARRTGNPDLVALGNRIVTVIGKPFTFNGVAVDLGASVGFALFPENGD
FT                   DLGQVIRHSDCAMYVAKKQGRNLVKPFVPSMQDELAKRVRLEADLRAAIKKAEIVPYYQ
FT                   PLVDLKTNRIIGFEALARWKTASGEFIPPNEFIPVAEEAGLIVELTDQLLRHACADALS
FT                   WPNELVLSFNLSPIQLSDRLLGLRILKILGDVGLPAHRVELEVTESAIIQDAVTARIVL
FT                   DDLVNAGVRIALDDFGTGYSSLSQLSNYRFDKIKIDRSFVSSFETNDKQDKVIKAIIAL
FT                   GAGLGVTITAEGIEEESQLQRLQDLGCDIGQGYLLGRPAPAAELATDHVSTRILQRG"
     MPRSQPTRPQ IEIVAWLAIF LLLFCLSWLF QWHEGLDEFI EKHHDYPLDH ALLALNISGF        60
     LGLIYSALRI RDLSREVHRR LQAEKNVDWI ACHDTLTELP NRRFLDSICA QAMSDQRAQE       120
     TYAVFSIDLD GFKKVNDLLG HDHGDAVLKT VAQRLSSLFP RERVFRLGGD EFVVLARRTG       180
     NPDLVALGNR IVTVIGKPFT FNGVAVDLGA SVGFALFPEN GDDLGQVIRH SDCAMYVAKK       240
     QGRNLVKPFV PSMQDELAKR VRLEADLRAA IKKAEIVPYY QPLVDLKTNR IIGFEALARW       300
     KTASGEFIPP NEFIPVAEEA GLIVELTDQL LRHACADALS WPNELVLSFN LSPIQLSDRL       360
     LGLRILKILG DVGLPAHRVE LEVTESAIIQ DAVTARIVLD DLVNAGVRIA LDDFGTGYSS       420
     LSQLSNYRFD KIKIDRSFVS SFETNDKQDK VIKAIIALGA GLGVTITAEG IEEESQLQRL       480
     QDLGCDIGQG YLLGRPAPAA ELATDHVSTR ILQRG                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page