(data stored in ACNUC7421 zone)

EMBL: CP001622.PE122

CP001622.PE122       Location/Qualifiers
FT   CDS             complement(117457..118131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_4441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54434"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA8"
FT                   /inference="similar to AA sequence:KEGG:Smed_4441"
FT                   /protein_id="ACS54434.1"
FT                   /translation="MAPDMSTVPRRSTTGLRKFLDPEQQRDWVEGEADLIDAEERSESL
FT                   EQRFKYVARYEKLLRRPQAQDVLEILRVYGQTCIPIPRKTERHYWSVSCLPSTSDKPLI
FT                   RVNASWMELFTLYADGEGLRARFLVHLSHFTTDHSPAQGDVDEPFLEDCVTTPEDVGYF
FT                   FPRGEDIFGITVRGSASIRKFLAERRILRAIRTFNVTHMNRGRNAYQASHCYSLADTML
FT                   AD"
     MAPDMSTVPR RSTTGLRKFL DPEQQRDWVE GEADLIDAEE RSESLEQRFK YVARYEKLLR        60
     RPQAQDVLEI LRVYGQTCIP IPRKTERHYW SVSCLPSTSD KPLIRVNASW MELFTLYADG       120
     EGLRARFLVH LSHFTTDHSP AQGDVDEPFL EDCVTTPEDV GYFFPRGEDI FGITVRGSAS       180
     IRKFLAERRI LRAIRTFNVT HMNRGRNAYQ ASHCYSLADT MLAD                        224
//

If you have problems or comments...

PBIL Back to PBIL home page