(data stored in ACNUC7421 zone)

EMBL: CP001622.PE123

CP001622.PE123       Location/Qualifiers
FT   CDS             complement(118384..118860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0124"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: ret:RHE_CH00463
FT                   fucose dissimilation pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54435"
FT                   /db_xref="GOA:C6AZA9"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZA9"
FT                   /inference="protein motif:PFAM:PF05025"
FT                   /protein_id="ACS54435.1"
FT                   /translation="MLKGLDPLLSPELLLTLRAMGHGDEIAIVDGNYPGVEHARRLIRL
FT                   DGHHLIPVLNAVLSVLPIDDFVAEAIFRSTVKAERDKLDPVHEEMIDCCARHEPHRQVV
FT                   PLIGQDFYGRVKTAHALIQTGEPRLYANIILRKGVIYPKEPGTHAAAGVDPFVY"
     MLKGLDPLLS PELLLTLRAM GHGDEIAIVD GNYPGVEHAR RLIRLDGHHL IPVLNAVLSV        60
     LPIDDFVAEA IFRSTVKAER DKLDPVHEEM IDCCARHEPH RQVVPLIGQD FYGRVKTAHA       120
     LIQTGEPRLY ANIILRKGVI YPKEPGTHAA AGVDPFVY                               158
//

If you have problems or comments...

PBIL Back to PBIL home page