(data stored in ACNUC7421 zone)

EMBL: CP001622.PE124

CP001622.PE124       Location/Qualifiers
FT   CDS             complement(118844..120091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0125"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG:
FT                   rec:RHECIAT_CH0000535 sugar transcriptional regulator
FT                   protein, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54436"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB0"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACS54436.1"
FT                   /translation="MSTLDGPEHTPVPPPILNPAGGANQVRVRAYNERLVLSLVRLYGT
FT                   LSKADIARRSGLSAQTVSVIMRVLEKEGLLSRGEPVRGRVGQPSIPMHINPDAVYSFGL
FT                   KMGRRSADLVLMDFVGRIRMQLHRTYAYPLPDEILAFVTSGIRELEDRLDDKQRSRIAG
FT                   LGIAAPFELWNWAEEVGAPPGAMEVWRDVDLQADIAARVSHPVFMQNDATSACGAELVF
FT                   GVGPSYPDFVYFFIGSFIGGGIVLNSAIFSGRTGTAGAIGPLPVRGKNGETMQLLEIAS
FT                   IFVLENMLRERGIDPEPLWYSADGWVDFGEPMEAWIQDSAKALAQAIVAAASIVDFSAA
FT                   VIDGGFPDWVRSRVVQATIDEAAKLDLQGVVMPEIIEGAVGAQARAIGGASLPIFARYL
FT                   TDQNVLFKEVDHAERT"
     MSTLDGPEHT PVPPPILNPA GGANQVRVRA YNERLVLSLV RLYGTLSKAD IARRSGLSAQ        60
     TVSVIMRVLE KEGLLSRGEP VRGRVGQPSI PMHINPDAVY SFGLKMGRRS ADLVLMDFVG       120
     RIRMQLHRTY AYPLPDEILA FVTSGIRELE DRLDDKQRSR IAGLGIAAPF ELWNWAEEVG       180
     APPGAMEVWR DVDLQADIAA RVSHPVFMQN DATSACGAEL VFGVGPSYPD FVYFFIGSFI       240
     GGGIVLNSAI FSGRTGTAGA IGPLPVRGKN GETMQLLEIA SIFVLENMLR ERGIDPEPLW       300
     YSADGWVDFG EPMEAWIQDS AKALAQAIVA AASIVDFSAA VIDGGFPDWV RSRVVQATID       360
     EAAKLDLQGV VMPEIIEGAV GAQARAIGGA SLPIFARYLT DQNVLFKEVD HAERT            415
//

If you have problems or comments...

PBIL Back to PBIL home page