(data stored in ACNUC7421 zone)

EMBL: CP001622.PE125

CP001622.PE125       Location/Qualifiers
FT   CDS             120320..121339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0126"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: ret:RHE_CH00465 fructose
FT                   ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54437"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB1"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS54437.1"
FT                   /translation="MKKSVLAFGALALGVTFSAPVMAADVAACLITKTDTNPFFVKMKE
FT                   GATAKAKELGVSLKSYAGKVDGDSESQVAAIESCIADGAKGILIAASDTKGIVSSVKKA
FT                   RDAGLLVIALDTPLEPADAADATFATDNLLAGKLIGQWAKETMGDKAKDAKVGFLDLTP
FT                   SQPTVDVLRDQGFMMGFGIDPKDPNKIGDEDDARIVGHDVTNGNEEGGRKAMENLLQKD
FT                   PSINVIHTINEPAAVGAYQALKAVGMEKNVLIVSVDGGCPGVKSVKEGVIGATSQQYPL
FT                   MMAALGVEAIKKFADSGEKPKPTEGKSFYDTGVSLVTDKPVSGVKSIDTKEGTDKCWG"
     MKKSVLAFGA LALGVTFSAP VMAADVAACL ITKTDTNPFF VKMKEGATAK AKELGVSLKS        60
     YAGKVDGDSE SQVAAIESCI ADGAKGILIA ASDTKGIVSS VKKARDAGLL VIALDTPLEP       120
     ADAADATFAT DNLLAGKLIG QWAKETMGDK AKDAKVGFLD LTPSQPTVDV LRDQGFMMGF       180
     GIDPKDPNKI GDEDDARIVG HDVTNGNEEG GRKAMENLLQ KDPSINVIHT INEPAAVGAY       240
     QALKAVGMEK NVLIVSVDGG CPGVKSVKEG VIGATSQQYP LMMAALGVEA IKKFADSGEK       300
     PKPTEGKSFY DTGVSLVTDK PVSGVKSIDT KEGTDKCWG                              339
//

If you have problems or comments...

PBIL Back to PBIL home page