(data stored in ACNUC7421 zone)

EMBL: CP001622.PE126

CP001622.PE126       Location/Qualifiers
FT   CDS             121495..122559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0127"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rec:RHECIAT_CH0000537 fructose ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54438"
FT                   /db_xref="GOA:C6AZB2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB2"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS54438.1"
FT                   /translation="MTGTQEFERVLDGSDKSVASFEHEKVSLIKRAQHFLHSTPAAVPL
FT                   IVLVLAIVIFGITIGGRFFSSYTLTLILQQIAIVGILGAAQTLVILTAGIDLSIGVIMV
FT                   ISAVIMGNVAITYGIPTPIAVAAGMLVGGLCGLLNGFLVAYMKLPPFIVTLGTWNIVMA
FT                   TNFIYSANETIRDTDVDEKAPLLHLFAVSFKLGSAVLTLGVIAMVLLVLVLWYVLNHTA
FT                   WGRHVYAVGDDPEAAKLSGIQTKKVLLTVYAISGVIAGLAAWVSIGRNGSISPSSAVTD
FT                   FNLQAITATVIGGISLFGGRGSILGTLFGAMIVGVVSMGLNMLGADPQWKVLLTGVLII
FT                   AAVAIDQWIRKVSV"
     MTGTQEFERV LDGSDKSVAS FEHEKVSLIK RAQHFLHSTP AAVPLIVLVL AIVIFGITIG        60
     GRFFSSYTLT LILQQIAIVG ILGAAQTLVI LTAGIDLSIG VIMVISAVIM GNVAITYGIP       120
     TPIAVAAGML VGGLCGLLNG FLVAYMKLPP FIVTLGTWNI VMATNFIYSA NETIRDTDVD       180
     EKAPLLHLFA VSFKLGSAVL TLGVIAMVLL VLVLWYVLNH TAWGRHVYAV GDDPEAAKLS       240
     GIQTKKVLLT VYAISGVIAG LAAWVSIGRN GSISPSSAVT DFNLQAITAT VIGGISLFGG       300
     RGSILGTLFG AMIVGVVSMG LNMLGADPQW KVLLTGVLII AAVAIDQWIR KVSV             354
//

If you have problems or comments...

PBIL Back to PBIL home page