(data stored in ACNUC7421 zone)

EMBL: CP001622.PE127

CP001622.PE127       Location/Qualifiers
FT   CDS             122562..123344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0128"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000538 fructose ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54439"
FT                   /db_xref="GOA:C6AZB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54439.1"
FT                   /translation="MAREPLLTARGLVKRYGRVTALDNADFDLYPGEILAVIGDNGAGK
FT                   SSLIKAISGAVTPDEGVITLEGRQVQFRSPMEARDAGIETVYQNLALSPALSIADNMFL
FT                   GREIRKPGVLGSMFRMLDRPAMEKLARNKLSELGLMTIQNINQAVETLSGGQRQGVAVA
FT                   RAAAFGSKVIIMDEPTAALGVKESRRVLELILDVRARGLPIVLISHNMPHVFEVADRIH
FT                   IHRLGRRLTVIDPKEYTMSDAVAFMTGAKAVPTEPVAA"
     MAREPLLTAR GLVKRYGRVT ALDNADFDLY PGEILAVIGD NGAGKSSLIK AISGAVTPDE        60
     GVITLEGRQV QFRSPMEARD AGIETVYQNL ALSPALSIAD NMFLGREIRK PGVLGSMFRM       120
     LDRPAMEKLA RNKLSELGLM TIQNINQAVE TLSGGQRQGV AVARAAAFGS KVIIMDEPTA       180
     ALGVKESRRV LELILDVRAR GLPIVLISHN MPHVFEVADR IHIHRLGRRL TVIDPKEYTM       240
     SDAVAFMTGA KAVPTEPVAA                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page