(data stored in ACNUC7421 zone)

EMBL: CP001622.PE128

CP001622.PE128       Location/Qualifiers
FT   CDS             123341..123973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0129"
FT                   /product="putative fructose transport system kinase"
FT                   /note="KEGG: ret:RHE_CH00468 putative fructose transport
FT                   system kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54440"
FT                   /db_xref="GOA:C6AZB4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB4"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00468"
FT                   /protein_id="ACS54440.1"
FT                   /translation="MNARIDEIAGEVLDRAGHSKRFLVAIAGPPGAGKSTMADNLAEAL
FT                   KAKGESAEVLPMDGFHMDNAILIERGLLARKGIPETFDVRGFLDIIRAVRLADQEVLVP
FT                   VFDRSRELAIASARPVSPDHRFIIVEGNYLLFSLGKWAELEGVFDFSIMLAPPIEVLEE
FT                   RLWARWRGYNLTEEAANAKVYGNDLPNGRLILENRRPADVTLEIALA"
     MNARIDEIAG EVLDRAGHSK RFLVAIAGPP GAGKSTMADN LAEALKAKGE SAEVLPMDGF        60
     HMDNAILIER GLLARKGIPE TFDVRGFLDI IRAVRLADQE VLVPVFDRSR ELAIASARPV       120
     SPDHRFIIVE GNYLLFSLGK WAELEGVFDF SIMLAPPIEV LEERLWARWR GYNLTEEAAN       180
     AKVYGNDLPN GRLILENRRP ADVTLEIALA                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page