(data stored in ACNUC7421 zone)

EMBL: CP001622.PE129

CP001622.PE129       Location/Qualifiers
FT   CDS             124085..125131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0130"
FT                   /product="dihydroorotase, homodimeric type"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: rec:RHECIAT_CH0000540 dihydroorotase protein;
FT                   TIGRFAM: dihydroorotase, homodimeric type; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54441"
FT                   /db_xref="GOA:C6AZB5"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB5"
FT                   /inference="protein motif:TFAM:TIGR00856"
FT                   /protein_id="ACS54441.1"
FT                   /translation="MQSITIRRPDDWHLHLRDGAMLEGVIADTSRTFARAIIMPNLVPP
FT                   VVTSADAKAYRERILKALPDGHRFQPLMTLYLTEHTSPDDVEEGKNSGLITAVKLYPAG
FT                   ATTNSHGGVRDMEKAMPVLERMAKIGLPLCVHGEVTTPEVDIFDREAVFIETVLDPLRQ
FT                   RLPELKVTMEHVTTSDGVDYIKTAKGNLAGSITTHHLIINRNAILVGGIRPHYYCLPVA
FT                   KRENHRLALRAAAVSGDARFFLGTDSAPHVDPLKECACGCAGIYTSVNTMSCLAHVFEQ
FT                   EGALERLEAFVSLNGPAWYGLQPNEERITLARQADPVVFPARIETGAGPVTVFDPMFPL
FT                   HWQVVQQA"
     MQSITIRRPD DWHLHLRDGA MLEGVIADTS RTFARAIIMP NLVPPVVTSA DAKAYRERIL        60
     KALPDGHRFQ PLMTLYLTEH TSPDDVEEGK NSGLITAVKL YPAGATTNSH GGVRDMEKAM       120
     PVLERMAKIG LPLCVHGEVT TPEVDIFDRE AVFIETVLDP LRQRLPELKV TMEHVTTSDG       180
     VDYIKTAKGN LAGSITTHHL IINRNAILVG GIRPHYYCLP VAKRENHRLA LRAAAVSGDA       240
     RFFLGTDSAP HVDPLKECAC GCAGIYTSVN TMSCLAHVFE QEGALERLEA FVSLNGPAWY       300
     GLQPNEERIT LARQADPVVF PARIETGAGP VTVFDPMFPL HWQVVQQA                    348
//

If you have problems or comments...

PBIL Back to PBIL home page