(data stored in ACNUC7421 zone)

EMBL: CP001622.PE13

CP001622.PE13        Location/Qualifiers
FT   CDS             10650..11054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54325"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54325.1"
FT                   /translation="MNQSHRFLFHTQRPRDDGCGVLVLQMLTGMSYDEVAAMIDWGDKS
FT                   AHYTTWNDLCGVLAEIGVPIEAPIKTSRWSDIQGVAIVHVQRDHFMLYDAENGLFYDPA
FT                   EMEGPGVASDRIPTSYLTVDPSALTTAKIG"
     MNQSHRFLFH TQRPRDDGCG VLVLQMLTGM SYDEVAAMID WGDKSAHYTT WNDLCGVLAE        60
     IGVPIEAPIK TSRWSDIQGV AIVHVQRDHF MLYDAENGLF YDPAEMEGPG VASDRIPTSY       120
     LTVDPSALTT AKIG                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page