(data stored in ACNUC7421 zone)

EMBL: CP001622.PE130

CP001622.PE130       Location/Qualifiers
FT   CDS             125305..126483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0131"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: ret:RHE_CH00470 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54442"
FT                   /db_xref="GOA:C6AZB6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS54442.1"
FT                   /translation="MMLDYNSLLLALGVSAACLAVTLMGSWLVRRSETVLLTATVGLVL
FT                   VVSGIFVYSAYVDTPETWLGVANFVLFHAGFATIWGAGKQFLTGRVSLPAIAIRALAAM
FT                   VFSVVPMLSGYDGLAFIADNLAIALLLFATARQYWLARAEAPAPLLGITVLYTLTAISF
FT                   VLCAAVLISDGKLVLGKAPSNWAEDLSLAVCIAGMTGIGALSLALHQWRLAARHRLDAI
FT                   TDPLTGLLNRRALFDQYGTRPMGTTTAVIVFDIDHFKSVNDRFGHAAGDRVLNVFSGEL
FT                   SAHCRTGDTAARLGGEEFVLVLKEIMPGRAELTAERIRRAFEAREIHIDDEVLTCTVSV
FT                   GVAPGRSKSLDFDTMLSAADKALYVAKRAGRNRVELASYLKAVPVEATRTAS"
     MMLDYNSLLL ALGVSAACLA VTLMGSWLVR RSETVLLTAT VGLVLVVSGI FVYSAYVDTP        60
     ETWLGVANFV LFHAGFATIW GAGKQFLTGR VSLPAIAIRA LAAMVFSVVP MLSGYDGLAF       120
     IADNLAIALL LFATARQYWL ARAEAPAPLL GITVLYTLTA ISFVLCAAVL ISDGKLVLGK       180
     APSNWAEDLS LAVCIAGMTG IGALSLALHQ WRLAARHRLD AITDPLTGLL NRRALFDQYG       240
     TRPMGTTTAV IVFDIDHFKS VNDRFGHAAG DRVLNVFSGE LSAHCRTGDT AARLGGEEFV       300
     LVLKEIMPGR AELTAERIRR AFEAREIHID DEVLTCTVSV GVAPGRSKSL DFDTMLSAAD       360
     KALYVAKRAG RNRVELASYL KAVPVEATRT AS                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page