(data stored in ACNUC7421 zone)

EMBL: CP001622.PE131

CP001622.PE131       Location/Qualifiers
FT   CDS             126674..127210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0132"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rec:RHECIAT_CH0000542 putative
FT                   glyoxalase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54443"
FT                   /db_xref="GOA:C6AZB7"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB7"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54443.1"
FT                   /translation="MRDFRDAKLMAKTLRQALADRDISLTHSETLEIVARQFGLDQWNI
FT                   LSAKIDAAGANPSAIGIEPPMPIFRIFSVEKAMEFYCGFLGFHLDWEHRFGENFPLYCQ
FT                   VSRDGMALHLSEHSGDASPGAKAFVRVANIRAYHAELSGKDYRYMKPGVEQAPWGLEMT
FT                   VIDPFSNRIAFCEQK"
     MRDFRDAKLM AKTLRQALAD RDISLTHSET LEIVARQFGL DQWNILSAKI DAAGANPSAI        60
     GIEPPMPIFR IFSVEKAMEF YCGFLGFHLD WEHRFGENFP LYCQVSRDGM ALHLSEHSGD       120
     ASPGAKAFVR VANIRAYHAE LSGKDYRYMK PGVEQAPWGL EMTVIDPFSN RIAFCEQK         178
//

If you have problems or comments...

PBIL Back to PBIL home page