(data stored in ACNUC7421 zone)

EMBL: CP001622.PE132

CP001622.PE132       Location/Qualifiers
FT   CDS             complement(127443..128390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0133"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: hne:HNE_3446
FT                   ISHne3, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54444"
FT                   /db_xref="GOA:C6AZB8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB8"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACS54444.1"
FT                   /translation="MHIQQSFMVGIDVSKAHLDVAVEGKRAVVRFDNNAPGCAALTAAV
FT                   AGAELVVVEATGGYEMAIVRTLMAAGIAVAVVNPRQVRDFARASGRLAKTDQVDARVTL
FT                   HFARAMRPAQIPHIDDGRIALAALVTRRRQLIDMAVAEKNRLEHAPEAVAALIGETLAA
FT                   LRAQLARVDAAIALAIEAEPDMAARRNLLLTVPGIGEVSAAVLIAELPELGAIDDKKLA
FT                   ALVGVAPIAHDSGTWRGQRHIAGGRATVRCALYMATLSAIRCNPAIKTFHKRLRDAGKP
FT                   PKVAIVAAMRKLIIMINTILKRRTPWNQPQQHGC"
     MHIQQSFMVG IDVSKAHLDV AVEGKRAVVR FDNNAPGCAA LTAAVAGAEL VVVEATGGYE        60
     MAIVRTLMAA GIAVAVVNPR QVRDFARASG RLAKTDQVDA RVTLHFARAM RPAQIPHIDD       120
     GRIALAALVT RRRQLIDMAV AEKNRLEHAP EAVAALIGET LAALRAQLAR VDAAIALAIE       180
     AEPDMAARRN LLLTVPGIGE VSAAVLIAEL PELGAIDDKK LAALVGVAPI AHDSGTWRGQ       240
     RHIAGGRATV RCALYMATLS AIRCNPAIKT FHKRLRDAGK PPKVAIVAAM RKLIIMINTI       300
     LKRRTPWNQP QQHGC                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page