(data stored in ACNUC7421 zone)

EMBL: CP001622.PE133

CP001622.PE133       Location/Qualifiers
FT   CDS             complement(128895..129524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0134"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   mlo:mlr2042 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54445"
FT                   /db_xref="GOA:C6AZB9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZB9"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ACS54445.1"
FT                   /translation="MFTLHDYLPSQNGWKVRVLLGLLDMPYHSRIVSIFEGENRTETFL
FT                   ELNPVGAIPVLELDDGRAIAESNAILTFLAEGTRFLPSDHYLRAKVMQWLFFEQYHVEP
FT                   VIGSLRFWTLTGRLERNQSMVAGKREAAARALAAIDRRLTDSLFLVGQQLTIADIAVYA
FT                   YSHRAEDCGFSLAAYPTFSAWSGRVRDAIGADHPVYPYSMDPHSAG"
     MFTLHDYLPS QNGWKVRVLL GLLDMPYHSR IVSIFEGENR TETFLELNPV GAIPVLELDD        60
     GRAIAESNAI LTFLAEGTRF LPSDHYLRAK VMQWLFFEQY HVEPVIGSLR FWTLTGRLER       120
     NQSMVAGKRE AAARALAAID RRLTDSLFLV GQQLTIADIA VYAYSHRAED CGFSLAAYPT       180
     FSAWSGRVRD AIGADHPVYP YSMDPHSAG                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page