(data stored in ACNUC7421 zone)

EMBL: CP001622.PE134

CP001622.PE134       Location/Qualifiers
FT   CDS             complement(129622..130104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0135"
FT                   /product="conserved hypothetical conserved membrane
FT                   protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000543 hypothetical conserved
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54446"
FT                   /db_xref="GOA:C6AZC0"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000543"
FT                   /protein_id="ACS54446.1"
FT                   /translation="MQIFLTLFLVAAAIGSGLVAGIFFAFSTFIMTAFSRIPAEQGIAA
FT                   MNSINVTIVRSPFMGLFVPTAILCLVIAVLALIDWRGGASFLMLAGAALYIFASFLSTI
FT                   IFNVPMNDALAKVGGNGPEAVQLWATYVRDWTRWNHVRTIASLLASVAFVRALMIV"
     MQIFLTLFLV AAAIGSGLVA GIFFAFSTFI MTAFSRIPAE QGIAAMNSIN VTIVRSPFMG        60
     LFVPTAILCL VIAVLALIDW RGGASFLMLA GAALYIFASF LSTIIFNVPM NDALAKVGGN       120
     GPEAVQLWAT YVRDWTRWNH VRTIASLLAS VAFVRALMIV                             160
//

If you have problems or comments...

PBIL Back to PBIL home page