(data stored in ACNUC7421 zone)

EMBL: CP001622.PE135

CP001622.PE135       Location/Qualifiers
FT   CDS             complement(130107..130931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0136"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: rpd:RPD_2341 NmrA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54447"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC1"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACS54447.1"
FT                   /translation="MQTSEIVLVGGSGKTGSRIIKRLEARGLTVRAASRSSARPFDWED
FT                   RSTWRGALEGASSAYVAFQPDLSVAWAAEAIEALARVAVECGLEHIVLLSGRGEEGAQR
FT                   SEAALKASGINTTILRASWFCQNFSEGAFVEQIIGGRLQLPAGEISEPFIDADDIADAA
FT                   VAALTDPGHRNKTYELTGPRALTFRQAVAEIAQAAGRPIEYEQVSMADFTGGLADAGLP
FT                   QGLIDLLEELFSQVLDGRNSGTMGGVAEILGRPATDFSECARRTAATGLWSA"
     MQTSEIVLVG GSGKTGSRII KRLEARGLTV RAASRSSARP FDWEDRSTWR GALEGASSAY        60
     VAFQPDLSVA WAAEAIEALA RVAVECGLEH IVLLSGRGEE GAQRSEAALK ASGINTTILR       120
     ASWFCQNFSE GAFVEQIIGG RLQLPAGEIS EPFIDADDIA DAAVAALTDP GHRNKTYELT       180
     GPRALTFRQA VAEIAQAAGR PIEYEQVSMA DFTGGLADAG LPQGLIDLLE ELFSQVLDGR       240
     NSGTMGGVAE ILGRPATDFS ECARRTAATG LWSA                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page