(data stored in ACNUC7421 zone)

EMBL: CP001622.PE136

CP001622.PE136       Location/Qualifiers
FT   CDS             131033..131686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0137"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ret:RHE_CH00473
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54448"
FT                   /db_xref="GOA:C6AZC2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54448.1"
FT                   /translation="MSEQPVATRRRQQESTGQLRRIPSQQRGRERFEKILTVAAELIES
FT                   HGSDGLKMSEIVEKAGLSFGALYQYFPDKTSIIRTLAERFNEEGRRCVEEELAKVTDAA
FT                   ALQGALANIVDEYYAFFRREPVMRDIWHATHTDKLLQQVDAVDMEFHAQAFLAVLIRLW
FT                   PDRDRRELLVIARLTMQLLAAAVRYAVSLDAEEGAQAIALFKKMQIVDIGSLLQ"
     MSEQPVATRR RQQESTGQLR RIPSQQRGRE RFEKILTVAA ELIESHGSDG LKMSEIVEKA        60
     GLSFGALYQY FPDKTSIIRT LAERFNEEGR RCVEEELAKV TDAAALQGAL ANIVDEYYAF       120
     FRREPVMRDI WHATHTDKLL QQVDAVDMEF HAQAFLAVLI RLWPDRDRRE LLVIARLTMQ       180
     LLAAAVRYAV SLDAEEGAQA IALFKKMQIV DIGSLLQ                                217
//

If you have problems or comments...

PBIL Back to PBIL home page