(data stored in ACNUC7421 zone)

EMBL: CP001622.PE137

CP001622.PE137       Location/Qualifiers
FT   CDS             131759..132448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0138"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: ret:RHE_CH00474 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54449"
FT                   /db_xref="GOA:C6AZC3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC3"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ACS54449.1"
FT                   /translation="MIQTTFPDRAVMAELLAKMLWEIKAVHFNAAQPYKLSSGMASPVY
FT                   IDCRKLLSFPRIRSTVMDFAASILLRDAGFEQFDCIAGGETAGIPFAALLADRLGLPMI
FT                   YVRKQPKGHGRNAQIEGNMPEGSRVLVIEDLTTAGGSMFKFIDAVRAAGGIVDHGIALF
FT                   FYGIFGEQRFADGKVRLHHIATWRNVLAVAKEQKLFDDKTLSEVEAFLDAPLAWSGRNG
FT                   GVSELSL"
     MIQTTFPDRA VMAELLAKML WEIKAVHFNA AQPYKLSSGM ASPVYIDCRK LLSFPRIRST        60
     VMDFAASILL RDAGFEQFDC IAGGETAGIP FAALLADRLG LPMIYVRKQP KGHGRNAQIE       120
     GNMPEGSRVL VIEDLTTAGG SMFKFIDAVR AAGGIVDHGI ALFFYGIFGE QRFADGKVRL       180
     HHIATWRNVL AVAKEQKLFD DKTLSEVEAF LDAPLAWSGR NGGVSELSL                   229
//

If you have problems or comments...

PBIL Back to PBIL home page