(data stored in ACNUC7421 zone)

EMBL: CP001622.PE138

CP001622.PE138       Location/Qualifiers
FT   CDS             132510..133436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0139"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG:
FT                   rec:RHECIAT_CH0000546 fructokinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54450"
FT                   /db_xref="GOA:C6AZC4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC4"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACS54450.1"
FT                   /translation="MILCCGEALIDMLPRDTTLGEKGFAPYAGGAIFNTAIALGRLGIP
FT                   TAFFTGIADDMMGEILLETLKASNVDYSPCAITPHPSTIAFVKLVNGQATYAFYDEGTA
FT                   GRMITTADLPDLGDDCEALHFGAISLIPSPCGETYEALLDREAARRVISLDPNIRPGFI
FT                   KDKPSHMARIKRMAAKADIVKFSDEDLEWFGLQGDHDALAAHWLNHGAKLVVITKGAEG
FT                   ASGYTKERKVTVPSERVTVVDTVGAGDTFDAGILASLKMDNLLTKRQVASLDEQALRNA
FT                   LTLGAKAAAVTVSRAGANPPWAREIGL"
     MILCCGEALI DMLPRDTTLG EKGFAPYAGG AIFNTAIALG RLGIPTAFFT GIADDMMGEI        60
     LLETLKASNV DYSPCAITPH PSTIAFVKLV NGQATYAFYD EGTAGRMITT ADLPDLGDDC       120
     EALHFGAISL IPSPCGETYE ALLDREAARR VISLDPNIRP GFIKDKPSHM ARIKRMAAKA       180
     DIVKFSDEDL EWFGLQGDHD ALAAHWLNHG AKLVVITKGA EGASGYTKER KVTVPSERVT       240
     VVDTVGAGDT FDAGILASLK MDNLLTKRQV ASLDEQALRN ALTLGAKAAA VTVSRAGANP       300
     PWAREIGL                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page