(data stored in ACNUC7421 zone)

EMBL: CP001622.PE139

CP001622.PE139       Location/Qualifiers
FT   CDS             complement(133611..134018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0140"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; Helix-turn-helix type
FT                   11 domain protein; SMART: regulatory protein ArsR; KEGG:
FT                   ret:RHE_CH00427 ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54451"
FT                   /db_xref="GOA:C6AZC5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC5"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACS54451.1"
FT                   /translation="MMQQARRPDLDEETFDDAVEGRSVSAAQRVFHALSSAPRRKILAY
FT                   LSASGLTAGEIADRFSMSKPAVSQHLSILEAAGLIRREKQGQFVHYSLIENNLVNTLNG
FT                   FVQEVCPVGRPIKKESQARTRGGLVPAKPAK"
     MMQQARRPDL DEETFDDAVE GRSVSAAQRV FHALSSAPRR KILAYLSASG LTAGEIADRF        60
     SMSKPAVSQH LSILEAAGLI RREKQGQFVH YSLIENNLVN TLNGFVQEVC PVGRPIKKES       120
     QARTRGGLVP AKPAK                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page