(data stored in ACNUC7421 zone)

EMBL: CP001622.PE14

CP001622.PE14        Location/Qualifiers
FT   CDS             complement(11244..11945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0014"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="PFAM: putative methyltransferase; KEGG:
FT                   rec:RHECIAT_CH0000409 probable tRNA
FT                   (guanine-N(7)-)-methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54326"
FT                   /db_xref="GOA:C6AYA2"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA2"
FT                   /inference="protein motif:PRIAM:2.1.1.33"
FT                   /protein_id="ACS54326.1"
FT                   /translation="MTDMERRGRATEAFFGRRKGKALREQQAETLNSLLPAFLIDLTAA
FT                   PPEPLTSLFPVPVERLRLEIGFGGGEHLIHRALNTPSTGFIGVEPFVNSMQKLLSRIGE
FT                   TGASNIRVYNDDATQLLDWLPDGSLDQVDLLYPDPWPKRKHWKRRFVSKTNLDRFHRVL
FT                   KPGGLFCFASDIDTYVNWTLIKCRDHGGFDWMADNAADWLTPYEGWPSTRYEAKARREG
FT                   RSSAYLTFRKI"
     MTDMERRGRA TEAFFGRRKG KALREQQAET LNSLLPAFLI DLTAAPPEPL TSLFPVPVER        60
     LRLEIGFGGG EHLIHRALNT PSTGFIGVEP FVNSMQKLLS RIGETGASNI RVYNDDATQL       120
     LDWLPDGSLD QVDLLYPDPW PKRKHWKRRF VSKTNLDRFH RVLKPGGLFC FASDIDTYVN       180
     WTLIKCRDHG GFDWMADNAA DWLTPYEGWP STRYEAKARR EGRSSAYLTF RKI              233
//

If you have problems or comments...

PBIL Back to PBIL home page