(data stored in ACNUC7421 zone)

EMBL: CP001622.PE140

CP001622.PE140       Location/Qualifiers
FT   CDS             134161..135123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0141"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: ret:RHE_CH00426
FT                   fatty acid desaturase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54452"
FT                   /db_xref="GOA:C6AZC6"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC6"
FT                   /inference="protein motif:PFAM:PF00487"
FT                   /protein_id="ACS54452.1"
FT                   /translation="MSSISTGRMIDNSSDAVKGRVVWMPAKSIWITAMTLIAVIGGPLT
FT                   FTWSAFAVFILLTAITICLGHSVGMHRLLIHRSFSTHTWIEHFLVYLGTVVGMAGPFGM
FT                   IYAHDIRDWAQRQRDCHDLYAHRRSFFIDAFWQMHCIVALDHPPRFVLEERERRDRFYR
FT                   FLEATWMAQQIPLGLALFALGGLPWVVWGIAVRISVSLTGHWLVGHFAHRDGHQGWSVD
FT                   DVAVQGYNLPRFGLVTFGESFHGNHHAFPDSARLGIEPGQLDLGWYFIGLLARLGLASA
FT                   IKLPHTIVPRRGLRRVNATETAGDSHPPHHAAGHAESRP"
     MSSISTGRMI DNSSDAVKGR VVWMPAKSIW ITAMTLIAVI GGPLTFTWSA FAVFILLTAI        60
     TICLGHSVGM HRLLIHRSFS THTWIEHFLV YLGTVVGMAG PFGMIYAHDI RDWAQRQRDC       120
     HDLYAHRRSF FIDAFWQMHC IVALDHPPRF VLEERERRDR FYRFLEATWM AQQIPLGLAL       180
     FALGGLPWVV WGIAVRISVS LTGHWLVGHF AHRDGHQGWS VDDVAVQGYN LPRFGLVTFG       240
     ESFHGNHHAF PDSARLGIEP GQLDLGWYFI GLLARLGLAS AIKLPHTIVP RRGLRRVNAT       300
     ETAGDSHPPH HAAGHAESRP                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page