(data stored in ACNUC7421 zone)

EMBL: CP001622.PE141

CP001622.PE141       Location/Qualifiers
FT   CDS             complement(135199..136614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0142"
FT                   /product="alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="KEGG: ret:RHE_CH00476 trehalose-6-phosphate synthase
FT                   protein; TIGRFAM: alpha,alpha-trehalose-phosphate synthase
FT                   [UDP-forming]; PFAM: glycosyl transferase family 20"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54453"
FT                   /db_xref="GOA:C6AZC7"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC7"
FT                   /inference="protein motif:TFAM:TIGR02400"
FT                   /protein_id="ACS54453.1"
FT                   /translation="MSRLVVVSNRVPMPAKDGSAAAGGLAVALQAALQERGGIWMGWSG
FT                   ESSGDREPGPLSQLQKGNITYALTDLTDTDVEEYYRGFANRVLWPICHYRLDLAEYGRK
FT                   EMAGYFRVNRFFAHRLAPMIEPDDIIWVHDYHLIPLAAELRQMGLKNRIGFFLHIPWPP
FT                   ADILVTMPVHEEIMRGLSHYDLVGFQTDYDLQNFAGYLRREGIGDDLGNGLFDSHGRIF
FT                   KAGAYPIGIETAAFAEFAERAANNIMVQKTRRSVEGRDMIIGVDRLDYSKGIIQRLEAF
FT                   ETFLTSNPAYQNKVTYLQVTPKSRSEVPEYEHMQGMVAEQAGRVNGAIGTVDWVPIRYV
FT                   NRSISRNVLAGLYRLATIGLVTPLRDGMNLVAKEYVAAQDPDRPGVLVLSRFAGAAREL
FT                   KGALLVNPYDVEGTANAIAKGLAMSLEERRDRWSMMMEHLLTHDVSLWCENFLGDLVLA
FT                   PELRPERDSRIGS"
     MSRLVVVSNR VPMPAKDGSA AAGGLAVALQ AALQERGGIW MGWSGESSGD REPGPLSQLQ        60
     KGNITYALTD LTDTDVEEYY RGFANRVLWP ICHYRLDLAE YGRKEMAGYF RVNRFFAHRL       120
     APMIEPDDII WVHDYHLIPL AAELRQMGLK NRIGFFLHIP WPPADILVTM PVHEEIMRGL       180
     SHYDLVGFQT DYDLQNFAGY LRREGIGDDL GNGLFDSHGR IFKAGAYPIG IETAAFAEFA       240
     ERAANNIMVQ KTRRSVEGRD MIIGVDRLDY SKGIIQRLEA FETFLTSNPA YQNKVTYLQV       300
     TPKSRSEVPE YEHMQGMVAE QAGRVNGAIG TVDWVPIRYV NRSISRNVLA GLYRLATIGL       360
     VTPLRDGMNL VAKEYVAAQD PDRPGVLVLS RFAGAARELK GALLVNPYDV EGTANAIAKG       420
     LAMSLEERRD RWSMMMEHLL THDVSLWCEN FLGDLVLAPE LRPERDSRIG S                471
//

If you have problems or comments...

PBIL Back to PBIL home page