(data stored in ACNUC7421 zone)

EMBL: CP001622.PE142

CP001622.PE142       Location/Qualifiers
FT   CDS             complement(137195..138820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0143"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   rec:RHECIAT_CH0000548 glucose-6-phosphate isomerase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54454"
FT                   /db_xref="GOA:C6AZC8"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC8"
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /protein_id="ACS54454.1"
FT                   /translation="MNAIVEQLKSTADATKATDIRAAFATDSQRFSRFSVALDDLLMDF
FT                   SKTAVNDDILKLLVKLAEDGGVETKREEMFSGKAINFTEDRAVLHTALRNRSNTPVLVD
FT                   GKDVMPDVNAVLAAMGKFADDVRSGTLKGATGKAITDVINIGIGGSDLGPVMATLALAP
FT                   FHDGPRAHFVSNIDGAHIADILKLVQPETTLFIVASKTFTTVETMTNAQTARNFIAKAL
FT                   GEAAVQHHFAAVSTALDKVAAFGIDSARVFGFWDWVGGRYSIWSAIGLPLMIAVGPENF
FT                   GKFLDGAHAVDNHFRKAPITENLPVLLGLIGFYHRNVLGYPTRAILPYDQRLSRFPAYL
FT                   QQLDMESNGKGVTIDGTPVEGNSGPVVWGEPGTNGQHAFYQLIHQGTSIIPAEFMIAAN
FT                   AFEPELRHQHQLLISNVLAQSEALMKGRTFAEAKKQLTDKGMDDKKADFIAPHRVFTGN
FT                   RPSITFVYDKLTPYALGRLIALYEHRVFVEGVLFRINSFDQWGVELGKELATGLLPVVE
FT                   GKESAAAHDSSTQGLVAALAKLAK"
     MNAIVEQLKS TADATKATDI RAAFATDSQR FSRFSVALDD LLMDFSKTAV NDDILKLLVK        60
     LAEDGGVETK REEMFSGKAI NFTEDRAVLH TALRNRSNTP VLVDGKDVMP DVNAVLAAMG       120
     KFADDVRSGT LKGATGKAIT DVINIGIGGS DLGPVMATLA LAPFHDGPRA HFVSNIDGAH       180
     IADILKLVQP ETTLFIVASK TFTTVETMTN AQTARNFIAK ALGEAAVQHH FAAVSTALDK       240
     VAAFGIDSAR VFGFWDWVGG RYSIWSAIGL PLMIAVGPEN FGKFLDGAHA VDNHFRKAPI       300
     TENLPVLLGL IGFYHRNVLG YPTRAILPYD QRLSRFPAYL QQLDMESNGK GVTIDGTPVE       360
     GNSGPVVWGE PGTNGQHAFY QLIHQGTSII PAEFMIAANA FEPELRHQHQ LLISNVLAQS       420
     EALMKGRTFA EAKKQLTDKG MDDKKADFIA PHRVFTGNRP SITFVYDKLT PYALGRLIAL       480
     YEHRVFVEGV LFRINSFDQW GVELGKELAT GLLPVVEGKE SAAAHDSSTQ GLVAALAKLA       540
     K                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page