(data stored in ACNUC7421 zone)

EMBL: CP001622.PE143

CP001622.PE143       Location/Qualifiers
FT   CDS             complement(138972..140672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0144"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rec:RHECIAT_CH0000549 long-chain-fatty-acid-CoA ligase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54455"
FT                   /db_xref="GOA:C6AZC9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZC9"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACS54455.1"
FT                   /translation="MNSISVHPNGAKPDKPWLAAYPDIVPAEIPPLEYVSLAELLEKSC
FT                   ARYADRTAFSSMGKGMRYRELESQTRKLAAWLQSTGLQKGDRVAVMMPNVLQNPIATYA
FT                   ILRAGLVVVNVNPLYTPRELEHQLKDSGAKAIFVLENFARTVEQVLNKTDLRHVVVTSL
FT                   GEMLGPKGLIVNFVVRKVKKLVPSWSIPQHKSFGQVLSEGAGKKLQPVALTGSDIAFLQ
FT                   YTGGTTGVAKGAMLTHQNLLANKAQLSLWLRSAFERKKEPEVLNFLCALPLYHIFALTV
FT                   NSLMGMSLGAHNILIANPRDIPGLVKEFEKSKVHIFPGLNTLFNALMNNADFAKLDFSS
FT                   LIMSLGGGMAVQRPVADRWLKMTGTAVTEGYGLSETSPVATANRFDSPEFTGTIGLPLP
FT                   STELDIRDEAGNSLPLGDVGEICIRGPQVMAGYWQKPEETARVMTDDGYFRSGDMGFMD
FT                   DRGYTKIVDRKKDMILVSGFNVYPNEIEEVAAMHAGILEAAAIGVPDGHSGEAVKLFVV
FT                   RKDPNLTEAEVKAHCIANLTNYKRPRFIEFRTELPKSPVGKILRKDLRG"
     MNSISVHPNG AKPDKPWLAA YPDIVPAEIP PLEYVSLAEL LEKSCARYAD RTAFSSMGKG        60
     MRYRELESQT RKLAAWLQST GLQKGDRVAV MMPNVLQNPI ATYAILRAGL VVVNVNPLYT       120
     PRELEHQLKD SGAKAIFVLE NFARTVEQVL NKTDLRHVVV TSLGEMLGPK GLIVNFVVRK       180
     VKKLVPSWSI PQHKSFGQVL SEGAGKKLQP VALTGSDIAF LQYTGGTTGV AKGAMLTHQN       240
     LLANKAQLSL WLRSAFERKK EPEVLNFLCA LPLYHIFALT VNSLMGMSLG AHNILIANPR       300
     DIPGLVKEFE KSKVHIFPGL NTLFNALMNN ADFAKLDFSS LIMSLGGGMA VQRPVADRWL       360
     KMTGTAVTEG YGLSETSPVA TANRFDSPEF TGTIGLPLPS TELDIRDEAG NSLPLGDVGE       420
     ICIRGPQVMA GYWQKPEETA RVMTDDGYFR SGDMGFMDDR GYTKIVDRKK DMILVSGFNV       480
     YPNEIEEVAA MHAGILEAAA IGVPDGHSGE AVKLFVVRKD PNLTEAEVKA HCIANLTNYK       540
     RPRFIEFRTE LPKSPVGKIL RKDLRG                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page